PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_31143_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 194aa    MW: 22142.3 Da    PI: 10.2255
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_31143_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.46.7e-322474151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Neem_31143_f_1 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 74
                    79***********************************************95 PP

2K-box76.66.5e-26101167369
           K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                     +++++ +ee+    +qqe+akL+ +i+nLq+++R++lGe+L+ Ls+keL++Le++Lek++++iRskK
  Neem_31143_f_1 101 NAQDNGVEEERFVFYQQEAAKLRVQISNLQNSNRNMLGESLSALSVKELKNLETRLEKGISRIRSKK 167
                     567888999*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-421675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.091676IPR002100Transcription factor, MADS-box
CDDcd002654.03E-451793No hitNo description
SuperFamilySSF554557.46E-341791IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-331838IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PfamPF003196.1E-272572IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-333853IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-335374IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.266112194IPR002487Transcription factor, K-box
PfamPF014861.4E-18114167IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MAFPNESREE SPKRKMGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
IVFSSRGRLY EYSNNSVKST IERYKKASAD SSTTGSVSEA NAQDNGVEEE RFVFYQQEAA  120
KLRVQISNLQ NSNRNMLGES LSALSVKELK NLETRLEKGI SRIRSKKPFP FFCSGLSVLY  180
CVQRLLDIVN LKHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-211688173Myocyte-specific enhancer factor 2B
1tqe_Q1e-211688173Myocyte-specific enhancer factor 2B
1tqe_R1e-211688173Myocyte-specific enhancer factor 2B
1tqe_S1e-211688173Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN0508541e-65JN050854.1 Mangifera indica cultivar SiJi AGAMOUS-like protein (AG1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449578.14e-94hypothetical protein CICLE_v10016427mg
RefseqXP_006449577.14e-94hypothetical protein CICLE_v10016427mg
RefseqXP_006449580.14e-94hypothetical protein CICLE_v10016427mg
SwissprotQ435856e-88AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLQ05KK34e-94Q05KK3_CITUN; MADS-box protein
TrEMBLV4TQL44e-94V4TQL4_9R
STRINGPGSC0003DMT4000731341e-83(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61812237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-79MIKC_MADS family protein